waste containers containers other
89-8695-03 "SNX-482 Recombinant, >=98% (HPLC)" SML1150-5UG CAS No:203460-30-4 CAS No:203460-30-4 SML1150
model:
89-8695-03
brand:
Sigma Aldrich Japan(Sigma-Aldrich)
category:
waste containers containers other
Product Description
Product Model: 89-8695-03Product Brand: Sigma Aldrich J […]
Contact Us
Product Details
Product Model: 89-8695-03
Product Brand: Sigma Aldrich Japan(Sigma-Aldrich)
Spec
- Synonym:GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD
- Size:5UG
- CAS No:203460-30-4
- For Bulk order information, please contact us.
- For search the English SDS, please click here.
- [English SDS]
- ※We ask for your kind understanding that lead time might change If it is out of stock in Japan.
- CAS No:203460-30-4
Related product recommendations
You may also be interested in the following products
waste containers containers other
63-8515-31 1 g 2,4-dibromobenzyl alcohol CAS No:666747-06-4 D5002-1G
model: 63-8515-31
brand: Tokyo Chemical Industry Co., Ltd.
waste containers containers other
63-8537-47 4 hydrazinobenzene sulfonic acid 100 g CAS No:98-71-5 H1662-100G
model: 63-8537-47
brand: Tokyo Chemical Industry Co., Ltd.
waste containers containers other
63-8503-91 1 g 2-chloro -3 cyano -4 methoxypyridine CAS No:98645-43-3 C3282-1G
model: 63-8503-91
brand: Tokyo Chemical Industry Co., Ltd.
waste containers containers other
89-8717-14 "Anti-Frataxin Antibody, clone 2F3 ZooMAb(R) Rabbit Monoclonal, recombinant, expressed in HEK 293 cells" ZRB1691-4X25UL ZRB1691
model: 89-8717-14
brand: Sigma Aldrich Japan(Sigma-Aldrich)