waste containers containers other
89-8695-03 "SNX-482 Recombinant, >=98% (HPLC)" SML1150-5UG CAS No:203460-30-4 CAS No:203460-30-4 SML1150
model:
89-8695-03
brand:
Sigma Aldrich Japan(Sigma-Aldrich)
category:
waste containers containers other
Product Description
Product Model: 89-8695-03Product Brand: Sigma Aldrich J […]
Contact Us
Product Details
Product Model: 89-8695-03
Product Brand: Sigma Aldrich Japan(Sigma-Aldrich)
Spec
- Synonym:GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD
- Size:5UG
- CAS No:203460-30-4
- For Bulk order information, please contact us.
- For search the English SDS, please click here.
- [English SDS]
- ※We ask for your kind understanding that lead time might change If it is out of stock in Japan.
- CAS No:203460-30-4
Related product recommendations
You may also be interested in the following products
waste containers containers other
63-8486-38 4 -Bromo -2, 2 '-bipyridyl 200 mg CAS No:14162-95-9 B5088-200MG
model: 63-8486-38
brand: Tokyo Chemical Industry Co., Ltd.
waste containers containers other
89-8690-82 "Anti-VGLUT1 Antibody, clone 3C10.2 ZooMAb(R) Mo*** Monoclonal, recombinant, expressed in HEK 293 cells" ZMS1109-25UL ZMS1109
model: 89-8690-82
brand: Sigma Aldrich Japan(Sigma-Aldrich)
waste containers containers other
89-8705-31 "Anti-hCG (Human Chorionic Gonadotropin) antibody, Rabbit monoclonal, recombinant, expressed in HEK 293 cells, clone RM330, purified immunoglobulin" SAB5600141-100UL SAB5600141
model: 89-8705-31
brand: Sigma Aldrich Japan(Sigma-Aldrich)
waste containers containers other
63-8550-53 Medroxyprogesterone 1 g CAS No:520-85-4 M3113-1G
model: 63-8550-53
brand: Tokyo Chemical Industry Co., Ltd.