waste containers containers other
89-8695-03 "SNX-482 Recombinant, >=98% (HPLC)" SML1150-5UG CAS No:203460-30-4 CAS No:203460-30-4 SML1150
model:
89-8695-03
brand:
Sigma Aldrich Japan(Sigma-Aldrich)
category:
waste containers containers other
Product Description
Product Model: 89-8695-03Product Brand: Sigma Aldrich J […]
Contact Us
Product Details
Product Model: 89-8695-03
Product Brand: Sigma Aldrich Japan(Sigma-Aldrich)
Spec
- Synonym:GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD
- Size:5UG
- CAS No:203460-30-4
- For Bulk order information, please contact us.
- For search the English SDS, please click here.
- [English SDS]
- ※We ask for your kind understanding that lead time might change If it is out of stock in Japan.
- CAS No:203460-30-4
Related product recommendations
You may also be interested in the following products
waste containers containers other
89-8689-81 "Anti-Proteinase 3/PR3 Antibody, clone 1L13 ZooMAb(R) Rabbit Monoclonal, recombinant, expressed in HEK 293 cells" ZRB2772-4X25UL ZRB2772
model: 89-8689-81
brand: Sigma Aldrich Japan(Sigma-Aldrich)
waste containers containers other
4-2913-50 Analytical Reagent Dimethyl Sulfoxide (DMSO) 1 L 35535-3080
model: 4-2913-50
brand: JUNSEI CHEMICAL
waste containers containers other
89-8702-36 "SP Bel-Art(R) Desi-Can(TM) Reusable Desiccant Canister, L × W × H 2 in. × 4 in. × 1/2 in." BAF420460000-1EA BAF420460000
model: 89-8702-36
brand: Sigma Aldrich Japan(Sigma-Aldrich)
waste containers containers other
63-8501-28 2 - Chloro -5 - methoxyaniline 5 g CAS No:2401-24-3 C3053-5G
model: 63-8501-28
brand: Tokyo Chemical Industry Co., Ltd.