waste containers containers other
89-8695-03 "SNX-482 Recombinant, >=98% (HPLC)" SML1150-5UG CAS No:203460-30-4 CAS No:203460-30-4 SML1150
model:
89-8695-03
brand:
Sigma Aldrich Japan(Sigma-Aldrich)
category:
waste containers containers other
Product Description
Product Model: 89-8695-03Product Brand: Sigma Aldrich J […]
Contact Us
Product Details
Product Model: 89-8695-03
Product Brand: Sigma Aldrich Japan(Sigma-Aldrich)
Spec
- Synonym:GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD
- Size:5UG
- CAS No:203460-30-4
- For Bulk order information, please contact us.
- For search the English SDS, please click here.
- [English SDS]
- ※We ask for your kind understanding that lead time might change If it is out of stock in Japan.
- CAS No:203460-30-4
Related product recommendations
You may also be interested in the following products
waste containers containers other
89-8689-33 "MAPTRIX-L-YIGSR, Laminin Mimetic, aqueous solution" 164144K-10MG 164144K
model: 89-8689-33
brand: Sigma Aldrich Japan(Sigma-Aldrich)
waste containers containers other
89-8723-72 "Anti-AUTS2 Antibody, clone 1D8 ZooMAb(R) Rabbit Monoclonal, recombinant, expressed in HEK 293 cells" ZRB1289-4X25UL ZRB1289
model: 89-8723-72
brand: Sigma Aldrich Japan(Sigma-Aldrich)
waste containers containers other
89-8724-57 "Monoclonal Anti-ITGB3 antibody produced in mo***, Prestige Antibodies(R) Powered by Atlas Antibodies, clone CL7319, purified immunoglobulin, buffered aqueous glycerol solution" AMAB91470-100UL AMAB91470
model: 89-8724-57
brand: Sigma Aldrich Japan(Sigma-Aldrich)
waste containers containers other
63-8566-48 Triphenylphosphine 100 g CAS No:603-35-0 T0519-100G
model: 63-8566-48
brand: Tokyo Chemical Industry Co., Ltd.