waste containers containers other
89-8695-03 "SNX-482 Recombinant, >=98% (HPLC)" SML1150-5UG CAS No:203460-30-4 CAS No:203460-30-4 SML1150
model:
89-8695-03
brand:
Sigma Aldrich Japan(Sigma-Aldrich)
category:
waste containers containers other
Product Description
Product Model: 89-8695-03Product Brand: Sigma Aldrich J […]
Contact Us
Product Details
Product Model: 89-8695-03
Product Brand: Sigma Aldrich Japan(Sigma-Aldrich)
Spec
- Synonym:GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD
- Size:5UG
- CAS No:203460-30-4
- For Bulk order information, please contact us.
- For search the English SDS, please click here.
- [English SDS]
- ※We ask for your kind understanding that lead time might change If it is out of stock in Japan.
- CAS No:203460-30-4
Related product recommendations
You may also be interested in the following products
waste containers containers other
89-8701-38 "1,4-Dimethylquinoxaline-2,3(1H,4H)-dione" TMT00233-1G CAS No:58175-07-8 CAS No:58175-07-8 TMT00233
model: 89-8701-38
brand: Sigma Aldrich Japan(Sigma-Aldrich)
waste containers containers other
89-8689-86 "Anti-RING1B/RNF2 Antibody, clone 9Q2W2, Rabbit Monoclonal" SAB5702347-100UL SAB5702347
model: 89-8689-86
brand: Sigma Aldrich Japan(Sigma-Aldrich)
waste containers containers other
89-8702-20 5-AMINO-2-(4-AMINOANILINO)-BENZENESULFONIC ACID S572039-250MG CAS No:119-70-0 CAS No:119-70-0 S572039
model: 89-8702-20
brand: Sigma Aldrich Japan(Sigma-Aldrich)
=95%" 902039-1G CAS No:1179361-66-0 CAS No:1179361-66-0 902039">
waste containers containers other
=95%" 902039-1G CAS No:1179361-66-0 CAS No:1179361-66-0 902039">89-8700-47 "4-Methoxypicolinimidamide hydrochloride, >=95%" 902039-1G CAS No:1179361-66-0 CAS No:1179361-66-0 902039
model: 89-8700-47
brand: Sigma Aldrich Japan(Sigma-Aldrich)